![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.25: Rv3472-like [160024] (3 proteins) similar trimer to Scytalone dehydratase |
![]() | Protein Uncharacterized protein NpunR3134 [160025] (1 species) |
![]() | Species Nostoc punctiforme [TaxId:272131] [160026] (1 PDB entry) Uniprot B2IXS6 1-133 |
![]() | Domain d2rgqc_: 2rgq C: [152020] automated match to d2rgqa1 complexed with gol, k, peg |
PDB Entry: 2rgq (more details), 1.8 Å
SCOPe Domain Sequences for d2rgqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgqc_ d.17.4.25 (C:) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} meltaldkleimelaarfemsldkedvenylatfasdgalqgfwgiakgkeelrqgfyam ldtfargkrhcssnaiiqgnydeatmesyltvvnredlnragsafvkdqvrkingkwyli lrqievdpslpllq
Timeline for d2rgqc_: