| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries) |
| Domain d1ymaa_: 1yma A: [15202] complexed with hem, so4 |
PDB Entry: 1yma (more details), 2 Å
SCOPe Domain Sequences for d1ymaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymaa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkygtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d1ymaa_: