Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.25: Rv3472-like [160024] (3 proteins) similar trimer to Scytalone dehydratase |
Protein Uncharacterized protein NpunR3134 [160025] (1 species) |
Species Nostoc punctiforme [TaxId:272131] [160026] (1 PDB entry) Uniprot B2IXS6 1-133 |
Domain d2rgqb_: 2rgq B: [152019] automated match to d2rgqa1 complexed with gol, k, peg |
PDB Entry: 2rgq (more details), 1.8 Å
SCOPe Domain Sequences for d2rgqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgqb_ d.17.4.25 (B:) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} meltaldkleimelaarfemsldkedvenylatfasdgalqgfwgiakgkeelrqgfyam ldtfargkrhcssnaiiqgnydeatmesyltvvnredlnragsafvkdqvrkingkwyli lrqievdpslpllq
Timeline for d2rgqb_: