SCOPe 2.06: Domain d2rgna1: 2rgn A:67-183

Lineage for d2rgna1 (2rgn A:67-183)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
   Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201

8. Domain d2rgna1: 2rgn A:67-183 [152012]
   Other proteins in same PDB: d2rgna2, d2rgnc1, d2rgnd2, d2rgnf1
   automatically matched to d2bcjq1
   complexed with alf, gdp, mg

Details for d2rgna1

PDB Entry: 2rgn, 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa

PDB Compounds: (A:) Guanine nucleotide-binding protein G(q) subunit alpha, Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d2rgna1:

Sequence; same for both SEQRES and ATOM records:

>d2rgna1 a.66.1.1 (A:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvr

Timeline for d2rgna1:

• d2rgna1 first appeared in SCOP 1.75
  
• d2rgna1 appears in SCOPe 2.05
  
• d2rgna1 appears in SCOPe 2.07
  
• d2rgna1 appears in the current release, SCOPe 2.08