SCOPe 2.06: Domain d2rg9b2: 2rg9 B:138-263

Lineage for d2rg9b2 (2rg9 B:138-263)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [225471] (6 PDB entries)

8. Domain d2rg9b2: 2rg9 B:138-263 [152009]
   Other proteins in same PDB: d2rg9a_
   automated match to d1sz6b2
   complexed with azi, cl, gol, nag, so4

Details for d2rg9b2

PDB Entry: 2rg9, 1.95 Å

PDB Description: crystal structure of viscum album mistletoe lectin i in native state at 1.95 a resolution, comparison of structure active site conformation in ricin and in viscumin

PDB Compounds: (B:) Beta-galactoside-specific lectin 1 chain B

SCOPe Domain Sequences for d2rg9b2:

Sequence; same for both SEQRES and ATOM records:

>d2rg9b2 b.42.2.1 (B:138-263) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetctigqenqrwalygdgsirpkqnqsqcltngrd
svstvinivscsagssgqrwvftnegailnlknglamdvaqanpklrriiiypatgnpnq
mwlpvp

Timeline for d2rg9b2:

• d2rg9b2 first appeared in SCOP 1.75
  
• d2rg9b2 appears in SCOPe 2.05
  
• d2rg9b2 appears in SCOPe 2.07
  
• d2rg9b2 appears in the current release, SCOPe 2.08