SCOPe 2.03: Domain d2rg9b2: 2rg9 B:138-263

Lineage for d2rg9b2 (2rg9 B:138-263)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (13 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d2rg9b2: 2rg9 B:138-263 [152009]
   Other proteins in same PDB: d2rg9a_
   automatically matched to d1pumb2
   complexed with azi, cl, gol, nag, so4

Details for d2rg9b2

PDB Entry: 2rg9, 1.95 Å

PDB Description: crystal structure of viscum album mistletoe lectin i in native state at 1.95 a resolution, comparison of structure active site conformation in ricin and in viscumin

PDB Compounds: (B:) Beta-galactoside-specific lectin 1 chain B

SCOPe Domain Sequences for d2rg9b2:

Sequence; same for both SEQRES and ATOM records:

>d2rg9b2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetctigqenqrwalygdgsirpkqnqsqcltngrd
svstvinivscsagssgqrwvftnegailnlknglamdvaqanpklrriiiypatgnpnq
mwlpvp

Timeline for d2rg9b2:

• d2rg9b2 first appeared in SCOP 1.75
  
• d2rg9b2 appears in SCOPe 2.02
  
• d2rg9b2 appears in SCOPe 2.04
  
• d2rg9b2 appears in the current release, SCOPe 2.08