![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein automated matches [190608] (4 species) not a true protein |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [225471] (6 PDB entries) |
![]() | Domain d2rg9b1: 2rg9 B:1-137 [152008] Other proteins in same PDB: d2rg9a_ automated match to d2rg9b1 complexed with azi, cl, gol, nag, so4 |
PDB Entry: 2rg9 (more details), 1.95 Å
SCOPe Domain Sequences for d2rg9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rg9b1 b.42.2.1 (B:1-137) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt vqtldytlgqgwlagnd
Timeline for d2rg9b1: