SCOP 1.75: Domain d2rg9b1: 2rg9 B:1-137

Lineage for d2rg9b1 (2rg9 B:1-137)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (10 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (14 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d2rg9b1: 2rg9 B:1-137 [152008]
   automatically matched to d1pumb1
   complexed with azi, cl, gol, nag, so4

Details for d2rg9b1

PDB Entry: 2rg9, 1.95 Å

PDB Description: crystal structure of viscum album mistletoe lectin i in native state at 1.95 a resolution, comparison of structure active site conformation in ricin and in viscumin

PDB Compounds: (B:) Beta-galactoside-specific lectin 1 chain B

SCOP Domain Sequences for d2rg9b1:

Sequence; same for both SEQRES and ATOM records:

>d2rg9b1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

Timeline for d2rg9b1:

• d2rg9b1 is new in SCOP 1.75
  
• d2rg9b1 appears in SCOPe 2.01
  
• d2rg9b1 appears in the current release, SCOPe 2.08