Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (141 PDB entries) |
Domain d2rg3a_: 2rg3 A: [152005] automated match to d1h1ba_ complexed with epe |
PDB Entry: 2rg3 (more details), 1.8 Å
SCOPe Domain Sequences for d2rg3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rg3a_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d2rg3a_: