SCOPe 2.01: Domain d2rfxa2: 2rfx A:1-181

Lineage for d2rfxa2 (2rfx A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)

8. Domain d2rfxa2: 2rfx A:1-181 [152003]
   Other proteins in same PDB: d2rfxa1, d2rfxb_
   automatically matched to d1a1ma2
   complexed with gol

Details for d2rfxa2

PDB Entry: 2rfx, 2.5 Å

PDB Description: crystal structure of hla-b*5701, presenting the self peptide, lsspvtksf

PDB Compounds: (A:) hla class I histocompatibility antigen, b-57 alpha chain

SCOPe Domain Sequences for d2rfxa2:

Sequence; same for both SEQRES and ATOM records:

>d2rfxa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d2rfxa2:

• d2rfxa2 first appeared in SCOP 1.75
  
• d2rfxa2 appears in SCOPe 2.02
  
• d2rfxa2 appears in the current release, SCOPe 2.08