Lineage for d2rfxa2 (2rfx A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856493Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)
  8. 856516Domain d2rfxa2: 2rfx A:1-181 [152003]
    Other proteins in same PDB: d2rfxa1, d2rfxb1
    automatically matched to d1a1ma2
    complexed with gol

Details for d2rfxa2

PDB Entry: 2rfx (more details), 2.5 Å

PDB Description: crystal structure of hla-b*5701, presenting the self peptide, lsspvtksf
PDB Compounds: (A:) hla class I histocompatibility antigen, b-57 alpha chain

SCOP Domain Sequences for d2rfxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfxa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d2rfxa2:

Click to download the PDB-style file with coordinates for d2rfxa2.
(The format of our PDB-style files is described here.)

Timeline for d2rfxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rfxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2rfxb1