Lineage for d2rftb_ (2rft B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2267354Species Influenza b virus (strain b/hong kong/8/73) [TaxId:11531] [255583] (2 PDB entries)
  8. 2267355Domain d2rftb_: 2rft B: [152001]
    Other proteins in same PDB: d2rfta_
    automated match to d1ti8b1
    complexed with nag

Details for d2rftb_

PDB Entry: 2rft (more details), 2.8 Å

PDB Description: Crystal structure of influenza B virus hemagglutinin in complex with LSTa receptor analog
PDB Compounds: (B:) Influenza B hemagglutinin (HA)

SCOPe Domain Sequences for d2rftb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rftb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza b virus (strain b/hong kong/8/73) [TaxId: 11531]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfds

SCOPe Domain Coordinates for d2rftb_:

Click to download the PDB-style file with coordinates for d2rftb_.
(The format of our PDB-style files is described here.)

Timeline for d2rftb_: