SCOPe 2.06: Domain d2rfra1: 2rfr A:1-153

Lineage for d2rfra1 (2rfr A:1-153)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins)
   PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA

6. Protein Uncharacterized protein Saro3722 [160039] (1 species)

7. Species Novosphingobium aromaticivorans [TaxId:48935] [160040] (1 PDB entry)
   Uniprot A4XF70 13-165

8. Domain d2rfra1: 2rfr A:1-153 [152000]
   Other proteins in same PDB: d2rfra2

Details for d2rfra1

PDB Entry: 2rfr, 1.16 Å

PDB Description: crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 a resolution

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2rfra1:

Sequence; same for both SEQRES and ATOM records:

>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]}
mddltnlaarlrlledreeireliarygpladsgdaealselwvedgeyavvgfatakgr
aaiaalidgqthralmadgcahflgpatvtvegdtatarchsvvfrcvsgtfgshrvsan
rwtfrrtpagwravrrenalldgsaaarallqf

Timeline for d2rfra1:

• d2rfra1 first appeared in SCOP 1.75
  
• d2rfra1 appears in SCOPe 2.05
  
• d2rfra1 appears in SCOPe 2.07
  
• d2rfra1 appears in the current release, SCOPe 2.08