Lineage for d1ymc__ (1ymc -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries) 
Domain d1ymc__: 1ymc - [15200]
Details for d1ymc__
PDB Entry: 1ymc (more details), 2 Å
PDB Description: three-dimensional structure of cyanomet-sulfmyoglobin c
SCOP Domain Sequences for d1ymc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymc__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
SCOP Domain Coordinates for d1ymc__:
Click to download the PDB-style file with coordinates for d1ymc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ymc__:
- d1ymc__ appears in SCOP 1.57
- d1ymc__ appears in the current release, SCOPe 2.08, called d1ymca_
View in 3D