SCOPe 2.06: Domain d2rfkc_: 2rfk C:

Lineage for d2rfkc_ (2rfk C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
   stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
   automatically mapped to Pfam PF04410

6. Protein Gar1 homolog PF1791 [141342] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries)
   Uniprot Q8U029 1-73

8. Domain d2rfkc_: 2rfk C: [151999]
   Other proteins in same PDB: d2rfka1, d2rfka2, d2rfkb_
   automated match to d2ey4c1
   protein/RNA complex; complexed with zn

Details for d2rfkc_

PDB Entry: 2rfk, 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex

PDB Compounds: (C:) Small nucleolar rnp similar to gar1

SCOPe Domain Sequences for d2rfkc_:

Sequence; same for both SEQRES and ATOM records:

>d2rfkc_ b.43.3.5 (C:) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvde

Timeline for d2rfkc_:

• d2rfkc_ first appeared in SCOP 1.75, called d2rfkc1
  
• d2rfkc_ appears in SCOPe 2.05
  
• d2rfkc_ appears in SCOPe 2.07
  
• d2rfkc_ appears in the current release, SCOPe 2.08