SCOP 1.75: Domain d2rfkb1: 2rfk B:4-55

Lineage for d2rfkb1 (2rfk B:4-55)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (2 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit ((75204))

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [144215] (3 PDB entries)
   Uniprot Q8U1R4 4-55

8. Domain d2rfkb1: 2rfk B:4-55 [151998]
   Other proteins in same PDB: d2rfka1, d2rfka2, d2rfkc1
   automatically matched to d2ey4e1
   complexed with zn; mutant

Details for d2rfkb1

PDB Entry: 2rfk, 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOP Domain Sequences for d2rfkb1:

Sequence; same for both SEQRES and ATOM records:

>d2rfkb1 g.41.16.1 (B:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d2rfkb1:

• d2rfkb1 is new in SCOP 1.75
  
• d2rfkb1 is called d2rfkb_ in SCOPe 2.01
  
• d2rfkb1 appears in the current release, SCOPe 2.08, called d2rfkb_