SCOPe 2.06: Domain d2rfka1: 2rfk A:253-341

Lineage for d2rfka1 (2rfk A:253-341)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (7 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [225693] (3 PDB entries)

8. Domain d2rfka1: 2rfk A:253-341 [151996]
   Other proteins in same PDB: d2rfka2, d2rfkb_, d2rfkc_
   automated match to d2ey4a1
   protein/RNA complex; complexed with zn

Details for d2rfka1

PDB Entry: 2rfk, 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2rfka1:

Sequence; same for both SEQRES and ATOM records:

>d2rfka1 b.122.1.0 (A:253-341) automated matches {Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypklwekrd

Timeline for d2rfka1:

• d2rfka1 first appeared in SCOP 1.75
  
• d2rfka1 appears in SCOPe 2.05
  
• d2rfka1 appears in SCOPe 2.07
  
• d2rfka1 appears in the current release, SCOPe 2.08