Lineage for d2rfka1 (2rfk A:253-336)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813148Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 813171Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 813174Species Archaeon Pyrococcus furiosus [TaxId:2261] [141699] (3 PDB entries)
    Uniprot Q7LWY0 250-333
  8. 813178Domain d2rfka1: 2rfk A:253-336 [151996]
    Other proteins in same PDB: d2rfka2, d2rfkb1, d2rfkc1
    automatically matched to d2ey4a1
    complexed with zn; mutant

Details for d2rfka1

PDB Entry: 2rfk (more details), 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOP Domain Sequences for d2rfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfka1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

SCOP Domain Coordinates for d2rfka1:

Click to download the PDB-style file with coordinates for d2rfka1.
(The format of our PDB-style files is described here.)

Timeline for d2rfka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rfka2