SCOPe 2.08: Domain d2reza2: 2rez A:1-152

Lineage for d2reza2 (2rez A:1-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
   Pfam PF03654

6. Protein Multifunctional enzyme TcmN, cyclase/aromatase domain [160740] (1 species)

7. Species Streptomyces glaucescens [TaxId:1907] [160741] (4 PDB entries)
   Uniprot P16559 1-152! Uniprot P16559 1-155

8. Domain d2reza2: 2rez A:1-152 [151992]
   Other proteins in same PDB: d2reza3
   automated match to d2rera1
   complexed with act, iod

Details for d2reza2

PDB Entry: 2rez, 1.95 Å

PDB Description: Tetracenomycin ARO/CYC NaI Structure

PDB Compounds: (A:) Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN

SCOPe Domain Sequences for d2reza2:

Sequence; same for both SEQRES and ATOM records:

>d2reza2 d.129.3.6 (A:1-152) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]}
maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang
rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf
dnahmtahlntttranmerikkiiedrhregq

Timeline for d2reza2:

• d2reza2 first appeared in SCOP 1.75, called d2reza1
  
• d2reza2 appears in SCOPe 2.07