SCOP 1.73: Domain d1ymba_: 1ymb A:

Lineage for d1ymba_ (1ymb A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (32 PDB entries)

8. Domain d1ymba_: 1ymb A: [15199]
   complexed with hem, so4

Details for d1ymba_

PDB Entry: 1ymb, 1.9 Å

PDB Description: high resolution study of the three-dimensional structure of horse heart metmyoglobin

PDB Compounds: (A:) metmyoglobin

SCOP Domain Sequences for d1ymba_:

Sequence; same for both SEQRES and ATOM records:

>d1ymba_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1ymba_:

• d1ymba_ first appeared (with stable ids) in SCOP 1.55, called d1ymb__
  
• d1ymba_ was called d1ymb__ in SCOP 1.71
  
• d1ymba_ appears in SCOP 1.75
  
• d1ymba_ appears in the current release, SCOPe 2.08