SCOP 1.71: Domain d1ymb__: 1ymb -

Lineage for d1ymb__ (1ymb -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries)

8. Domain d1ymb__: 1ymb - [15199]
   complexed with hem, so4

Details for d1ymb__

PDB Entry: 1ymb, 1.9 Å

PDB Description: high resolution study of the three-dimensional structure of horse heart metmyoglobin

SCOP Domain Sequences for d1ymb__:

Sequence; same for both SEQRES and ATOM records:

>d1ymb__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1ymb__:

• d1ymb__ first appeared (with stable ids) in SCOP 1.55
  
• d1ymb__ appears in SCOP 1.69
  
• d1ymb__ is called d1ymba_ in SCOP 1.73
  
• d1ymb__ appears in the current release, SCOPe 2.08, called d1ymba_