Lineage for d1ymb__ (1ymb -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350084Protein Myoglobin [46469] (9 species)
  7. 350089Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries)
  8. 350106Domain d1ymb__: 1ymb - [15199]
    complexed with hem, so4

Details for d1ymb__

PDB Entry: 1ymb (more details), 1.9 Å

PDB Description: high resolution study of the three-dimensional structure of horse heart metmyoglobin

SCOP Domain Sequences for d1ymb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymb__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1ymb__:

Click to download the PDB-style file with coordinates for d1ymb__.
(The format of our PDB-style files is described here.)

Timeline for d1ymb__: