Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins) Pfam PF02501 |
Protein Pseudopilin EpsI [160136] (1 species) |
Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries) Uniprot Q7MPZ1 63-143 |
Domain d2retg_: 2ret G: [151989] Other proteins in same PDB: d2reta2, d2retb1, d2retc3, d2retd_, d2rete3, d2retf_, d2reth_ automated match to d2reta1 complexed with cl, na |
PDB Entry: 2ret (more details), 2.21 Å
SCOPe Domain Sequences for d2retg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2retg_ d.24.1.7 (G:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]} tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf dvsvaattqaspiitvrsyva
Timeline for d2retg_: