Lineage for d2retf_ (2ret F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509544Family d.24.1.5: EpsJ-like [160127] (2 proteins)
    automatically mapped to Pfam PF11612
  6. 2509548Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 2509549Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 2509556Domain d2retf_: 2ret F: [151988]
    Other proteins in same PDB: d2reta1, d2reta2, d2retc2, d2retc3, d2rete2, d2rete3, d2retg_
    automated match to d2retb1
    complexed with cl, na

Details for d2retf_

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (F:) EpsJ

SCOPe Domain Sequences for d2retf_:

Sequence, based on SEQRES records: (download)

>d2retf_ d.24.1.5 (F:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
lsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimfa
rlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrf
ydgkqwinewsneltlpaaisveltlkdygkiartyltpegnlq

Sequence, based on observed residues (ATOM records): (download)

>d2retf_ d.24.1.5 (F:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
lsqertarlnelqralvmmdsdfrqialrqtrtkkllhwadylldsdnkgimfarlgwhn
pqqqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqwin
ewsneltlpaaisveltlkdygkiartyltpegnlq

SCOPe Domain Coordinates for d2retf_:

Click to download the PDB-style file with coordinates for d2retf_.
(The format of our PDB-style files is described here.)

Timeline for d2retf_: