Lineage for d2rete2 (2ret E:30-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941281Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins)
    Pfam PF02501
  6. 2941282Protein Pseudopilin EpsI [160136] (1 species)
  7. 2941283Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries)
    Uniprot Q7MPZ1 63-143
  8. 2941290Domain d2rete2: 2ret E:30-110 [151987]
    Other proteins in same PDB: d2reta2, d2retb1, d2retc3, d2retd_, d2rete3, d2retf_, d2reth_
    automated match to d2reta1
    complexed with cl, na

Details for d2rete2

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (E:) Pseudopilin EpsI

SCOPe Domain Sequences for d2rete2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rete2 d.24.1.7 (E:30-110) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf
dvsvaattqaspiitvrsyva

SCOPe Domain Coordinates for d2rete2:

Click to download the PDB-style file with coordinates for d2rete2.
(The format of our PDB-style files is described here.)

Timeline for d2rete2: