Lineage for d2retd_ (2ret D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941263Family d.24.1.5: EpsJ-like [160127] (2 proteins)
    automatically mapped to Pfam PF11612
  6. 2941267Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 2941268Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 2941274Domain d2retd_: 2ret D: [151986]
    Other proteins in same PDB: d2reta1, d2reta2, d2retc2, d2retc3, d2rete2, d2rete3, d2retg_
    automated match to d2retb1
    complexed with cl, na

Details for d2retd_

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (D:) EpsJ

SCOPe Domain Sequences for d2retd_:

Sequence, based on SEQRES records: (download)

>d2retd_ d.24.1.5 (D:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
qertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimfarl
gwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfyd
gkqwinewsneltlpaaisveltlkdygkiartyltpegnlqk

Sequence, based on observed residues (ATOM records): (download)

>d2retd_ d.24.1.5 (D:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
qertarlnelqralvmmdsdfrqialrqtrtkkllhwadylldsdnkgimfarlgwhnpq
qqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqwinew
sneltlpaaisveltlkdygkiartyltpegnlqk

SCOPe Domain Coordinates for d2retd_:

Click to download the PDB-style file with coordinates for d2retd_.
(The format of our PDB-style files is described here.)

Timeline for d2retd_: