Lineage for d1hsy__ (1hsy -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) Protein Myoglobin [46469] (9 species) 
Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries) 
Domain d1hsy__: 1hsy - [15198]
Details for d1hsy__
PDB Entry: 1hsy (more details), 1.9 Å
PDB Description: origin of the ph-dependent spectroscopic properties of pentacoordinate metmyoglobin variants
SCOP Domain Sequences for d1hsy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsy__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
SCOP Domain Coordinates for d1hsy__:
Click to download the PDB-style file with coordinates for d1hsy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hsy__:
- d1hsy__ first appeared (with stable ids) in SCOP 1.55
- d1hsy__ appears in SCOP 1.59
- d1hsy__ appears in the current release, SCOPe 2.08, called d1hsya_
View in 3D