Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2rehd1 (2reh D:261-430)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains)
  6. Protein Nitroalkane oxidase [140471] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
    Uniprot Q8X1D8 261-430
  8. Domain d2rehd1: 2reh D:261-430 [151979]
    Other proteins in same PDB: d2reha2, d2rehb2, d2rehc2, d2rehd2
    automatically matched to d2c0ua1
    complexed with fad

Details for d2rehd1

PDB Entry: 2reh (more details)
PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (D:) nitroalkane oxidase

SCOP Domain Sequences for d2rehd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rehd1 a.29.3.1 (D:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfeggniglrrrqmqrvmaledyepwaatyg

SCOP Domain Coordinates for d2rehd1:

Click to download the PDB-style file with coordinates for d2rehd1.
(The format of our PDB-style files is described here.)

Timeline for d2rehd1:

d2rehd1 appears in SCOP 1.75A


d2rehd1
(click for larger image)


d2rehd1 in context of chain
Domains from same chain:
d2rehd2


d2rehd1 in context of PDB
Domains from other chains:
d2reha1, d2reha2, d2rehb1, d2rehb2, d2rehc1, d2rehc2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu