| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains) |
| Protein Nitroalkane oxidase [140471] (1 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries) Uniprot Q8X1D8 261-430 |
| Domain d2rehd1: 2reh D:261-430 [151979] Other proteins in same PDB: d2reha2, d2rehb2, d2rehc2, d2rehd2 automatically matched to d2c0ua1 complexed with fad |
| PDB Entry: 2reh (more details) PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (D:) nitroalkane oxidaseSCOP Domain Sequences for d2rehd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rehd1 a.29.3.1 (D:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfeggniglrrrqmqrvmaledyepwaatyg
SCOP Domain Coordinates for d2rehd1:
Click to download the PDB-style file with coordinates for d2rehd1. (The format of our PDB-style files is described here.)
Timeline for d2rehd1:
d2rehd1 appears in SCOP 1.75A | d2rehd1 (click for larger image) d2rehd1 in context of chain Domains from same chain: d2rehd2 d2rehd1 in context of PDB Domains from other chains: d2reha1, d2reha2, d2rehb1, d2rehb2, d2rehc1, d2rehc2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |