Lineage for d2rehc2 (2reh C:2-260)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1233740Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1233741Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1233742Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 1233818Protein Nitroalkane oxidase [144026] (1 species)
  7. 1233819Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries)
    Uniprot Q8X1D8 2-260
  8. 1233832Domain d2rehc2: 2reh C:2-260 [151978]
    Other proteins in same PDB: d2reha1, d2rehb1, d2rehc1, d2rehd1
    automatically matched to d2c0ua2
    complexed with fad

Details for d2rehc2

PDB Entry: 2reh (more details), 2.4 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d2rehc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rehc2 e.6.1.1 (C:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOPe Domain Coordinates for d2rehc2:

Click to download the PDB-style file with coordinates for d2rehc2.
(The format of our PDB-style files is described here.)

Timeline for d2rehc2: