SCOPe 2.01: Domain d2rehc2: 2reh C:2-260

Lineage for d2rehc2 (2reh C:2-260)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)

6. Protein Nitroalkane oxidase [144026] (1 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries)
   Uniprot Q8X1D8 2-260

8. Domain d2rehc2: 2reh C:2-260 [151978]
   Other proteins in same PDB: d2reha1, d2rehb1, d2rehc1, d2rehd1
   automatically matched to d2c0ua2
   complexed with fad

Details for d2rehc2

PDB Entry: 2reh, 2.4 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase

PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d2rehc2:

Sequence; same for both SEQRES and ATOM records:

>d2rehc2 e.6.1.1 (C:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d2rehc2:

• d2rehc2 first appeared in SCOP 1.75
  
• d2rehc2 appears in SCOPe 2.02
  
• d2rehc2 appears in the current release, SCOPe 2.08