SCOP 1.75: Domain d2rehb2: 2reh B:2-260

Lineage for d2rehb2 (2reh B:2-260)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)

6. Protein Nitroalkane oxidase [144026] (1 species)

7. Species Fusarium oxysporum [TaxId:5507] [144027] (4 PDB entries)
   Uniprot Q8X1D8 2-260

8. Domain d2rehb2: 2reh B:2-260 [151976]
   Other proteins in same PDB: d2reha1, d2rehb1, d2rehc1, d2rehd1
   automatically matched to d2c0ua2
   complexed with fad; mutant

Details for d2rehb2

PDB Entry: 2reh, 2.4 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase

PDB Compounds: (B:) nitroalkane oxidase

SCOP Domain Sequences for d2rehb2:

Sequence; same for both SEQRES and ATOM records:

>d2rehb2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d2rehb2:

• d2rehb2 is new in SCOP 1.75
  
• d2rehb2 appears in SCOPe 2.01
  
• d2rehb2 appears in the current release, SCOPe 2.08