Lineage for d2rehb1 (2reh B:261-430)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267383Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1267384Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1267460Protein Nitroalkane oxidase [140471] (1 species)
  7. 1267461Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
    Uniprot Q8X1D8 261-430
  8. 1267473Domain d2rehb1: 2reh B:261-430 [151975]
    Other proteins in same PDB: d2reha2, d2rehb2, d2rehc2, d2rehd2
    automatically matched to d2c0ua1
    complexed with fad

Details for d2rehb1

PDB Entry: 2reh (more details), 2.4 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (B:) nitroalkane oxidase

SCOPe Domain Sequences for d2rehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rehb1 a.29.3.1 (B:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfeggniglrrrqmqrvmaledyepwaatyg

SCOPe Domain Coordinates for d2rehb1:

Click to download the PDB-style file with coordinates for d2rehb1.
(The format of our PDB-style files is described here.)

Timeline for d2rehb1: