Lineage for d1bjea_ (1bje A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717381Species Horse (Equus caballus) [TaxId:9796] [46474] (80 PDB entries)
  8. 1717433Domain d1bjea_: 1bje A: [15197]
    complexed with azi, hem, so4

Details for d1bjea_

PDB Entry: 1bje (more details), 1.8 Å

PDB Description: h64t variant of myoglobin (horse heart) recombinant wild-type complexed with azide
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1bjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjea_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d1bjea_:

Click to download the PDB-style file with coordinates for d1bjea_.
(The format of our PDB-style files is described here.)

Timeline for d1bjea_: