Lineage for d1bje__ (1bje -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44504Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries)
  8. 44512Domain d1bje__: 1bje - [15197]

Details for d1bje__

PDB Entry: 1bje (more details), 1.8 Å

PDB Description: h64t variant of myoglobin (horse heart) recombinant wild-type complexed with azide

SCOP Domain Sequences for d1bje__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bje__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1bje__:

Click to download the PDB-style file with coordinates for d1bje__.
(The format of our PDB-style files is described here.)

Timeline for d1bje__: