SCOP 1.73: Domain d1rsea_: 1rse A:

Lineage for d1rsea_ (1rse A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (32 PDB entries)

8. Domain d1rsea_: 1rse A: [15196]
   complexed with hem, so4; mutant

Details for d1rsea_

PDB Entry: 1rse, 1.7 Å

PDB Description: myoglobin (horse heart) mutant with ser 92 replaced by asp (s92d)

PDB Compounds: (A:) horse heart myoglobin

SCOP Domain Sequences for d1rsea_:

Sequence; same for both SEQRES and ATOM records:

>d1rsea_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqdhatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1rsea_:

• d1rsea_ first appeared (with stable ids) in SCOP 1.55, called d1rse__
  
• d1rsea_ was called d1rse__ in SCOP 1.71
  
• d1rsea_ appears in SCOP 1.75
  
• d1rsea_ appears in the current release, SCOPe 2.08