Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries) |
Domain d1rse__: 1rse - [15196] complexed with hem, so4; mutant |
PDB Entry: 1rse (more details), 1.7 Å
SCOP Domain Sequences for d1rse__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rse__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkhgtvvltalggilkkkghheaelkplaqdhatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d1rse__: