SCOP 1.71: Domain d1rse__: 1rse -

Lineage for d1rse__ (1rse -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries)

8. Domain d1rse__: 1rse - [15196]
   complexed with hem, so4; mutant

Details for d1rse__

PDB Entry: 1rse, 1.7 Å

PDB Description: myoglobin (horse heart) mutant with ser 92 replaced by asp (s92d)

SCOP Domain Sequences for d1rse__:

Sequence; same for both SEQRES and ATOM records:

>d1rse__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqdhatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1rse__:

• d1rse__ first appeared (with stable ids) in SCOP 1.55
  
• d1rse__ appears in SCOP 1.69
  
• d1rse__ is called d1rsea_ in SCOP 1.73
  
• d1rse__ appears in the current release, SCOPe 2.08, called d1rsea_