SCOP 1.69: Domain d1wla__: 1wla -

Lineage for d1wla__ (1wla -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries)

8. Domain d1wla__: 1wla - [15195]

Details for d1wla__

PDB Entry: 1wla, 1.7 Å

PDB Description: myoglobin (horse heart) recombinant wild-type

SCOP Domain Sequences for d1wla__:

Sequence; same for both SEQRES and ATOM records:

>d1wla__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1wla__:

• d1wla__ first appeared (with stable ids) in SCOP 1.55
  
• d1wla__ appears in SCOP 1.67
  
• d1wla__ appears in SCOP 1.71
  
• d1wla__ appears in the current release, SCOPe 2.08, called d1wlaa_