Lineage for d1wla__ (1wla -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 538Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries)
  8. 543Domain d1wla__: 1wla - [15195]

Details for d1wla__

PDB Entry: 1wla (more details), 1.7 Å

PDB Description: myoglobin (horse heart) recombinant wild-type

SCOP Domain Sequences for d1wla__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wla__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1wla__:

Click to download the PDB-style file with coordinates for d1wla__.
(The format of our PDB-style files is described here.)

Timeline for d1wla__: