Lineage for d2rdoi2 (2rdo I:1-72)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170073Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2170074Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2170075Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 protein domains)
    Pfam PF03946
  6. 2170079Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2170085Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2170110Domain d2rdoi2: 2rdo I:1-72 [151949]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc1, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoh2, d2rdoi1, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 I:1-72

Details for d2rdoi2

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50S subunit with EF-G(GDPNP) and RRF bound
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2rdoi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdoi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2rdoi2:

Click to download the PDB-style file with coordinates for d2rdoi2.
(The format of our PDB-style files is described here.)

Timeline for d2rdoi2: