Lineage for d2rdoi1 (2rdo I:73-141)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308822Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2308847Domain d2rdoi1: 2rdo I:73-141 [151948]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc1, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoh2, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 I:73-141

Details for d2rdoi1

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2rdoi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdoi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2rdoi1:

Click to download the PDB-style file with coordinates for d2rdoi1.
(The format of our PDB-style files is described here.)

Timeline for d2rdoi1: