Lineage for d2rdog1 (2rdo G:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873804Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 873853Domain d2rdog1: 2rdo G:1-81 [151944]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc1, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdoh1, d2rdoh2, d2rdoi1, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 G:1-81

Details for d2rdog1

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2rdog1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdog1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOP Domain Coordinates for d2rdog1:

Click to download the PDB-style file with coordinates for d2rdog1.
(The format of our PDB-style files is described here.)

Timeline for d2rdog1: