Lineage for d2rdoc2 (2rdo C:61-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399426Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2399436Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2399461Domain d2rdoc2: 2rdo C:61-124 [151940]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc1, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoh2, d2rdoi1, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 C:61-124

Details for d2rdoc2

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2rdoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdoc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d2rdoc2:

Click to download the PDB-style file with coordinates for d2rdoc2.
(The format of our PDB-style files is described here.)

Timeline for d2rdoc2: