Lineage for d2rdo81 (2rdo 8:1-185)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656074Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1656119Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1656120Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1656121Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1656124Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)
  8. 1656127Domain d2rdo81: 2rdo 8:1-185 [151938]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdoc1, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoh2, d2rdoi1, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to d1ek8a_

Details for d2rdo81

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (8:) ribosome recycling factor

SCOPe Domain Sequences for d2rdo81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdo81 d.67.3.1 (8:1-185) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

SCOPe Domain Coordinates for d2rdo81:

Click to download the PDB-style file with coordinates for d2rdo81.
(The format of our PDB-style files is described here.)

Timeline for d2rdo81: