Lineage for d1hrma_ (1hrm A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759581Species Horse (Equus caballus) [TaxId:9796] [46474] (45 PDB entries)
  8. 759602Domain d1hrma_: 1hrm A: [15193]
    complexed with hem, so4; mutant

Details for d1hrma_

PDB Entry: 1hrm (more details), 1.7 Å

PDB Description: the proximal ligand variant his93tyr of horse heart myoglobin
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1hrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrma_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqsyatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1hrma_:

Click to download the PDB-style file with coordinates for d1hrma_.
(The format of our PDB-style files is described here.)

Timeline for d1hrma_: