SCOPe 2.08: Domain d1hrma_: 1hrm A:

Lineage for d1hrma_ (1hrm A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d1hrma_: 1hrm A: [15193]
   complexed with hem, so4

Details for d1hrma_

PDB Entry: 1hrm, 1.7 Å

PDB Description: the proximal ligand variant his93tyr of horse heart myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1hrma_:

Sequence; same for both SEQRES and ATOM records:

>d1hrma_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqsyatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1hrma_:

• d1hrma_ first appeared (with stable ids) in SCOP 1.55, called d1hrm__
  
• d1hrma_ appears in SCOPe 2.07