![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.2: PilZ domain-like [141371] (2 families) ![]() |
![]() | Family b.45.2.1: PilZ domain [141372] (2 proteins) Pfam PF07238 |
![]() | Protein Hypothetical protein VCA0042, C-terminal domain [141373] (2 species) |
![]() | Species Vibrio cholerae O395 [TaxId:345073] [159171] (1 PDB entry) |
![]() | Domain d2rdeb1: 2rde B:138-247 [151926] Other proteins in same PDB: d2rdea2, d2rdeb2 automatically matched to d1ylna1 complexed with c2e |
PDB Entry: 2rde (more details), 1.92 Å
SCOPe Domain Sequences for d2rdeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdeb1 b.45.2.1 (B:138-247) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae O395 [TaxId: 345073]} eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln
Timeline for d2rdeb1: