SCOPe 2.03: Domain d2rdea2: 2rde A:24-137

Lineage for d2rdea2 (2rde A:24-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.2: PilZ domain-associated domain [141377] (2 proteins)
   this domain preceeds PilZ domain in some proteins
   automatically mapped to Pfam PF12945

6. Protein Hypothetical protein VCA0042, N-terminal domain [141378] (2 species)

7. Species Vibrio cholerae O395 [TaxId:345073] [159172] (1 PDB entry)

8. Domain d2rdea2: 2rde A:24-137 [151925]
   Other proteins in same PDB: d2rdea1, d2rdeb1
   automatically matched to d1ylna2
   complexed with c2e

Details for d2rdea2

PDB Entry: 2rde, 1.92 Å

PDB Description: crystal structure of vca0042 complexed with c-di-gmp

PDB Compounds: (A:) Uncharacterized protein VCA0042

SCOPe Domain Sequences for d2rdea2:

Sequence; same for both SEQRES and ATOM records:

>d2rdea2 b.45.2.2 (A:24-137) Hypothetical protein VCA0042, N-terminal domain {Vibrio cholerae O395 [TaxId: 345073]}
vstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlqy
ffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrk

Timeline for d2rdea2:

• d2rdea2 first appeared in SCOP 1.75
  
• d2rdea2 appears in SCOPe 2.02
  
• d2rdea2 appears in SCOPe 2.04
  
• d2rdea2 appears in the current release, SCOPe 2.08