Lineage for d2rdea2 (2rde A:24-137)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952712Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 952910Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 952921Family b.45.2.2: PilZ domain-associated domain [141377] (1 protein)
    this domain preceeds PilZ domain in some proteins
  6. 952922Protein Hypothetical protein VCA0042, N-terminal domain [141378] (2 species)
  7. 952923Species Vibrio cholerae O395 [TaxId:345073] [159172] (1 PDB entry)
  8. 952924Domain d2rdea2: 2rde A:24-137 [151925]
    Other proteins in same PDB: d2rdea1, d2rdeb1
    automatically matched to d1ylna2
    complexed with c2e

Details for d2rdea2

PDB Entry: 2rde (more details), 1.92 Å

PDB Description: crystal structure of vca0042 complexed with c-di-gmp
PDB Compounds: (A:) Uncharacterized protein VCA0042

SCOPe Domain Sequences for d2rdea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdea2 b.45.2.2 (A:24-137) Hypothetical protein VCA0042, N-terminal domain {Vibrio cholerae O395 [TaxId: 345073]}
vstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlqy
ffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrk

SCOPe Domain Coordinates for d2rdea2:

Click to download the PDB-style file with coordinates for d2rdea2.
(The format of our PDB-style files is described here.)

Timeline for d2rdea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdea1