SCOP 1.75: Domain d2rdea1: 2rde A:138-247

Lineage for d2rdea1 (2rde A:138-247)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.1: PilZ domain [141372] (2 proteins)
   Pfam PF07238

6. Protein Hypothetical protein VCA0042, C-terminal domain [141373] (2 species)

7. Species Vibrio cholerae O395 [TaxId:345073] [159171] (1 PDB entry)

8. Domain d2rdea1: 2rde A:138-247 [151924]
   Other proteins in same PDB: d2rdea2, d2rdeb2
   automatically matched to d1ylna1
   complexed with c2e

Details for d2rdea1

PDB Entry: 2rde, 1.92 Å

PDB Description: crystal structure of vca0042 complexed with c-di-gmp

PDB Compounds: (A:) Uncharacterized protein VCA0042

SCOP Domain Sequences for d2rdea1:

Sequence; same for both SEQRES and ATOM records:

>d2rdea1 b.45.2.1 (A:138-247) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae O395 [TaxId: 345073]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln

Timeline for d2rdea1:

• d2rdea1 is new in SCOP 1.75
  
• d2rdea1 appears in SCOPe 2.01
  
• d2rdea1 appears in the current release, SCOPe 2.08