SCOP 1.75: Domain d2rdbc1: 2rdb C:3-85

Lineage for d2rdbc1 (2rdb C:3-85)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (1 family)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
   Uniprot O87799

8. Domain d2rdbc1: 2rdb C:3-85 [151923]
   Other proteins in same PDB: d2rdbb1
   automatically matched to d1t0rc_
   complexed with fe, gol, mpo, p6g; mutant

Details for d2rdbc1

PDB Entry: 2rdb, 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant

PDB Compounds: (C:) Toluene, o-xylene monooxygenase oxygenase subunit;gamma

SCOP Domain Sequences for d2rdbc1:

Sequence; same for both SEQRES and ATOM records:

>d2rdbc1 d.15.12.1 (C:3-85) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d2rdbc1:

• d2rdbc1 is new in SCOP 1.75
  
• d2rdbc1 is called d2rdbc_ in SCOPe 2.01
  
• d2rdbc1 appears in the current release, SCOPe 2.08, called d2rdbc_